SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1140.Synpcc7942_0408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1140.Synpcc7942_0408
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.83e-54
Family Tryptophan biosynthesis enzymes 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1140.Synpcc7942_0408
Sequence length 217
Comment (Synechococcus elongatus PCC 7942)
Sequence
MGLRIKICGLRDPQQAIAIADLGATAIGFIAVRQSPRYVSPAQVAEIAQALQKTHPTVNR
VGVFANATAEELEAYVAAGITSLQLHGDETLADCQRWRDRFPALELIKALRIRSTADLAL
AESFTDCVDTLLLDAYHPQMLGGTGATLDWQALQAFQPSRPWLLAGGLTPENITTALSQL
HPAGIDLSSGVERSPGDKDLEKVTALFSSLARNSLLK
Download sequence
Identical sequences Q31R79
1140.Synpcc7942_0408 WP_011377568.1.45845 WP_011377568.1.95485 gi|81299219|ref|YP_399427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]