SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1140.Synpcc7942_1912 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1140.Synpcc7942_1912
Domain Number 1 Region: 14-223
Classification Level Classification E-value
Superfamily PhoU-like 3.45e-53
Family PhoU-like 0.0000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1140.Synpcc7942_1912
Sequence length 224
Comment (Synechococcus elongatus PCC 7942)
Sequence
MFHSTFEGLPSTRTRFMKQVKDVQQDILRMGALVENSCWLARQALVERDLSAPDQIDQQD
QVIDALYRKIEQDCLSLVALQSPVSRDLRILSAFMQIVRDLERIGDYAENLGEIAIRLFA
LAPHPIIEPVGLMLERSRSMLAMSLAAIANIDAELGRAIKDKDDAVDADFDALYDRLVHD
SQAQFNLEATVLLVLVIRHIERMADHATNVGQRICFIQSGRMPN
Download sequence
Identical sequences A0A0H3K5A5 Q31LX7
WP_011244493.1.45845 WP_011244493.1.5740 WP_011244493.1.95485 gi|81300721|ref|YP_400929.1| 1140.Synpcc7942_1912 269084.syc2183_d gi|56752192|ref|YP_172893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]