SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1148.sll0529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll0529
Domain Number 1 Region: 50-313
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.19e-30
Family TK-like PP module 0.0026
Further Details:      
 
Domain Number 2 Region: 381-574
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.12e-28
Family TK-like Pyr module 0.021
Further Details:      
 
Domain Number 3 Region: 579-730
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000141
Family Transketolase C-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1148.sll0529
Sequence length 731
Comment (Synechocystis PCC6803)
Sequence
MTVASTAPAFCQGIRFFGENLPDFDRYGQETAIASGAKAISSANDPQAVYQTLLAADALR
YLTLQTTASKESGHPGGFASIAEAIAALVMLGYKNTVTEVGHHAPGFYSTMFLDRSLEAM
GINNVQELGDRFREMHGLLGHLSGQIPGLLAPAGPLGQGQHFAMAGAKLYPGVLFPVTIG
DGGLGEPYIMSSFGHFHTAYPQVTNFLPILVWNGFSQEHHSMVSTQSNEAMVNYWQGNGF
KNVILVNAKDFDDSNQAGDFVDSTKFSFQQRLAFTQAVLEATDKAAQAALGGTLTVLIVK
QLKGAGVHKSGAKSHNLYPGDSLDKDYIVSALQERALSPEAWQLVRTNFERSHGGPASQT
VVTESVLPLADLGTLPLKEFALEDKQVATTAMGELVVHVGKQDSNFVVTNADGNAASGIN
NINVGLKIVHPTVDEDYFQQPNGQVYEPLSEDACAGLAAAQALFGGRTLWCSYESFAING
LPIWQTVTQAMAELRRPTPSTITLFTAGALEQGRNGWTHQRPEIENYFAAMMRNGNIFPL
FPCDANGIQVCYDWALTTSNKGIPITASKSPLPIRTTLEQNRQGLAKGGILLHNSTGSKT
IVFAVIGDMTLIPVLEAASQLESEGYGVKVVSVINPRRLYRPHDVQWQDCSEADSGFLSD
AEFTELFGGDALIGVTGGSGAMLEPVLLRSACPRDLFAWKRGETTASAGQLMAYNGLTAQ
ALGDRAKALLP
Download sequence
Identical sequences L8ANH3 Q55517
gi|16332076|ref|NP_442804.1| 1148.sll0529 WP_010874098.1.11876 WP_010874098.1.1889 WP_010874098.1.18904 WP_010874098.1.33690 WP_010874098.1.35395 WP_010874098.1.47586 WP_010874098.1.99424 gi|16332076|ref|NP_442804.1| gi|383323819|ref|YP_005384673.1| gi|383326988|ref|YP_005387842.1| gi|383492872|ref|YP_005410549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]