SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1148.sll1135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll1135
Domain Number 1 Region: 1-207,291-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.05e-36
Family HI0933 N-terminal domain-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1148.sll1135
Sequence length 334
Comment (Synechocystis PCC6803)
Sequence
MKQISVVIVGGGLCGLMAAVVLQLQGLEVTVLDKGKGIGGRLASRRLRHGDAVGCFDFGA
QYFKAQHPLFLAWVEDWIKAGVVKVWAEGMGTETGTIRSQGVKLYRGEPSNRSLAQYLAQ
DLKVVNQEKVNAFHWQDNIWQIHCDSGGIYQGDRLVVTAPLPQTLELLTVSNINLPADIQ
QTLTGVVYDPCFSLSLLLEQPSLVPDPGGLWLSGEPLAWMACSTKKGISPHGYGVTVQAG
PEFSRHYLATDTEQVIALMTAAAQPWSGSAVLASHLHLWRYSHPQNPLDQPFLFGDFPGP
VYFGGDAFHGGKVEGAALSGLAIAEHLLNSLAKG
Download sequence
Identical sequences P73476
1148.sll1135 gi|16330108|ref|NP_440836.1| gi|16330108|ref|NP_440836.1| WP_010872146.1.11876 WP_010872146.1.1889 WP_010872146.1.18904 WP_010872146.1.33690 WP_010872146.1.35395 WP_010872146.1.47586 WP_010872146.1.99424 gi|383321851|ref|YP_005382704.1| gi|383490904|ref|YP_005408580.1| gi|383325020|ref|YP_005385873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]