SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1148.sll1940 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll1940
Domain Number 1 Region: 57-149
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000654
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1148.sll1940
Sequence length 157
Comment (Synechocystis PCC6803)
Sequence
MFRLFNSGKLDKVVLFWMGLTSALVTFYPTPSYGQNSQNSFYNPIPITANTTVDDRLTVG
DMPTGEGGFARDYRINLQAGDQVSIDLRSDEFDTMVMLIGDDGTTIVANDDSTEGGTNSL
AFARITESGDYIVRVRTYAATGGGAFSLAVTRLKPVP
Download sequence
Identical sequences P73080
gi|383324609|ref|YP_005385462.1| gi|383321439|ref|YP_005382292.1| gi|16329697|ref|NP_440425.1| 1148.sll1940 WP_010871734.1.11876 WP_010871734.1.1889 WP_010871734.1.18904 WP_010871734.1.33690 WP_010871734.1.35395 WP_010871734.1.47586 WP_010871734.1.99424 gi|383490493|ref|YP_005408169.1| gi|16329697|ref|NP_440425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]