SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1148.sll1981 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll1981
Domain Number 1 Region: 358-543
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1e-61
Family Pyruvate oxidase and decarboxylase PP module 0.0000425
Further Details:      
 
Domain Number 2 Region: 2-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000223
Further Details:      
 
Domain Number 3 Region: 183-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.18e-43
Family Pyruvate oxidase and decarboxylase, middle domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1148.sll1981
Sequence length 550
Comment (Synechocystis PCC6803)
Sequence
MGQMNTADLLVQCLENEDVEYIFGVPGEENLHILEALKNSPIRFITTRHEQGAAFMADVY
GRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAM
FDPVTKWTRQIVRPSITPEVVRKAFKLAQSEKPGATHIDLPENIAAMPVDGKPLRRDSRE
KVYAAFRTLGTAANAISKAKNPIILAGNGTIRAEASEALTEFATSLNIPVANTFMGKGTM
PYTHPLSLWTVGLQQRDHITCAFEKSDLVIAVGYDLIEYSPKKWNPTGDLPIIHIGATPA
EIDSSYIPQVEVVGDITDSLMDLLKRCDRQGKPTPYGASLRAEIRAEYECYANDTGFPVK
PQKIIYDLRQVMGPDDVVISDVGAHKMWMARHYHCDSPNTCLISNGFAAMGIAIPGAIAA
KLVYPERNIVAVTGDGGFMMNCQELETAMRVGTPFVTLIFNDNGYGLIEWKQINQFGESS
FIKFGNPDFVKFAESMGLKGYRVEAAADLIPILKEALAQPVPTVIDCPVDYRENIRFSQK
AGELACEIWE
Download sequence
Identical sequences L8AJW6 P73918
gi|16330576|ref|NP_441304.1| gi|383491370|ref|YP_005409046.1| WP_010872609.1.11876 WP_010872609.1.1889 WP_010872609.1.18904 WP_010872609.1.33690 WP_010872609.1.35395 WP_010872609.1.47586 WP_010872609.1.99424 gi|383322317|ref|YP_005383170.1| 1148.sll1981 gi|383325486|ref|YP_005386339.1| gi|16330576|ref|NP_441304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]