SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1148.slr0628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.slr0628
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.77e-37
Family Ribosomal protein S14 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1148.slr0628
Sequence length 100
Comment (Synechocystis PCC6803)
Sequence
MAKKSMIERDKRRSRLVAKYAAKREALKEEFRQAETLEDKLAVHQKLQDLPRNSAPNRRR
NRCQVTGRPRSYYRDFGLCRNVLREWAHQGLLPGVTKSSW
Download sequence
Identical sequences L8AMZ4 P48944
gi|383323288|ref|YP_005384142.1| gi|383492341|ref|YP_005410018.1| WP_010873571.1.11876 WP_010873571.1.1889 WP_010873571.1.18904 WP_010873571.1.33690 WP_010873571.1.35395 WP_010873571.1.47586 WP_010873571.1.99424 gi|383326457|ref|YP_005387311.1| gi|16331546|ref|NP_442274.1| gi|16331546|ref|NP_442274.1| 1148.slr0628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]