SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002422584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  121224.XP_002422584
Domain Number - Region: 15-86
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002422584
Sequence length 121
Comment (Pediculus humanus corporis)
Sequence
MYIIYLLINLKSNDTEYQINKTYKRSRKKETKSPEEVNMKLKSNNAVIKSHQSILKFVKK
KKTKKEKIKENLSKSRRDADKDIDETATTTGTTTGTTTGTIKDSDFVGGKTKNKKKWFVK
I
Download sequence
Identical sequences E0V8Z0
vb|PHUM002190-PA|EEB09846.1|hypothetical XP_002422584.1.24195 121224.XP_002422584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]