SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002422766 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002422766
Domain Number 1 Region: 27-214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-43
Family SPRY domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002422766
Sequence length 335
Comment (Pediculus humanus corporis)
Sequence
MDFWEGTMSAFKENKSYCACLGEKDKKLTCICGEVDYEPVWKWDEKAKTSTVIISNNGQK
VYFHKGYSIGNACVRGDTPLLPGHDYYWEIKMLSSVYGTSMMIGIGTENFNINQSNLEFC
NLLGCDSESWGMRFDGTLHHNKKSSSYNLLAGFTMGSIIGVHLDMWNGKLEYYLNRIPLG
VAFSGLQNKILYPLLSSTASHTVMKLIFAHSEPHSLSLISAKYLNEKTFSSLPPGLKLYS
KTCWWLFPKSTRLKSDKKFDLLPSLYSIDMLIDSDEEESSNSTECNILAPRVRRVFEASA
AHNSFRSDNGAESRHFHSLAHVRPIRYRSKTWLDH
Download sequence
Identical sequences E0V9H2
XP_002422766.1.24195 vb|PHUM011770-PA|EEB10028.1|SPRY 121224.XP_002422766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]