SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002423095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002423095
Domain Number 1 Region: 104-171
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.36e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00082
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-19
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002423095
Sequence length 235
Comment (Pediculus humanus corporis)
Sequence
MCRKKEKPRQFFLFNDILVYGNIVISKKKYNKQHIIPLEEVKLESLDDNDQHRNGWVIQT
ATKSFAVYAATSVEKEEWVAHINKCVGDLLRKSGKKASETHAAVWIPDTEADVCMHCKKT
QFTLLTRRHHCRKCGSVVCGPCSNKRFLLPNQSSKPLRVCLNCYDNLSKAKTNHNNSGDC
YNKDGKLRSKFGDSSGEDDSDEDDESNKSADNSHDQVSLESVRVLNKKLSLVTYI
Download sequence
Identical sequences E0VAF1
XP_002423095.1.24195 121224.XP_002423095 vb|PHUM036310-PA|EEB10357.1|phafin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]