SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425362 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425362
Domain Number 1 Region: 881-1085
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 91-171
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000101
Family PDZ domain 0.0058
Further Details:      
 
Domain Number 3 Region: 727-853
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000125
Family PLC-like (P variant) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425362
Sequence length 1676
Comment (Pediculus humanus corporis)
Sequence
MAASPRRQQPANQPNKVKNPPPMVIQSDFRKVSGISTEIFRQIEQVENDHDATTAAALET
VDRRGEMVVRILDPRSMGRNSLEAAKIFLQMQDAKHIVQLVEIVKRPGQTLGLYIREGNG
MERSDGVFISRIALESAVYNSGCLQVGDEILAVNLVDVTRMSLDDVVIIMSIPRRLVLAI
RQKKGMRGMQPNQSPLLTSRESKPPPVVVIKKHFDDFDRDDNGMEDRRRSRSRLGLEFSH
ISRDHSEHNGLDLYYNSRPESSSEQWTYRPPPPPVITEQPKPQHFTPYDRQYPKTLESLA
EKVHAFYPAGTLDNRRGSPAYCSLGAGGSRDIRRVGNRIMPRSGSDQHLPRVEYDYGSSR
MSSRHSGSLLRSSLKSNTLGHPGYTSRFSDSSRGYNISYNMRDSTLSKKPKAPLDYSSDT
EATLSSKSLANYQRRGFSSGLTSSGLSRIGVTPVSSLRSNSLPRDHRGRGQLGQVSRQQS
LVRFDRNLTSNLLGDEDSDGVLSAPEMPSRRDRILSTPSVFTSDEYRAWLSRVPTSLLPR
SSSIISRTGTTHGISSISRTPSTSAIYERIRAGREAITQQRAQRFTFSAENLSLLDRNRE
DSRYLYRGHLNSTLDRPRPASTTPLSSGQSYLRGSDYRDKSTALQESADKSMRRIRQLME
LEASHIPHPSPRLQTDSRSRLLDINPAEFLKYKIEKSSSLQNSSSISSLHSNATNLPSSG
DPTEGMYGLLWVHLLAGRGLRASASASNQTMGGTTTGLRDLYCVLECDRVHKARTVVRTG
DIVFDWDETFELDLIGNRELDLLIYSWDPQYRHKLCYKGSVHLLSLLKQSSVHQLALKIE
PRGTLYLRLKYTDPHTSFSRKPSQQHILARPGSKPILTGGLFGSPLESTVIRENVLPGGM
MSNSTSMIQNVPLIIKNCVEEIERRGLDIIGLYRLCGSATKKRILREGFERNVRTVDLSP
DNVPDINVITGVLKDYLRELPEPLFTKCLFQMLVDVIAVCLPDDPEGNAKLIFSILDCLP
KVNRAAVIFLMDHLSLVVSQCDRNKMTAQNLSVIFGPILMLHAEPGTDLDFNQPIAILRY
LLEVWKHQSVRDLVCSTGALFNNSRDHHSSGANPLTRQPPLPQHMISSKQVLHGVQDKSN
PGPVVVTSPGSPTSESSRSSSSISPSEGNEILSGSKSLLSNKNFKMMDSSGLNLLTNKSS
SQISLLGSNSSITNKSPSQISLLGSNSSINSLARSIPDSKTYSSGSIYQPNSRKSPLLDR
SKSPYGSPNLSDRSKSPYFQTATKTSYGSPILEKSKNYSQNLERSKSPMDKAMKNLYSSP
GLTTSRDLTKSPLLKNGEYSSVTLDRYGSNKTGHVDSEHKNELNLDRMSGLPLSMTSSQI
YDSNQSGDKPLFSTLPRQRSIPTIIGMPRRLSEQRKSLPQVPTDKIKDYMDGKTVDSESK
NPFEKLEGFTISANPTGKNPFLDENEEQYNYETVSSRVSCFEQKAGNGNDKMDNSTKMNP
YVGIHTAQNAMYQTSIGQYGTVMTTSIPPSQNQSTTRSMTCLQYSVPVSSGHVHSSLKKP
SSTIENQGNQNNLQFHSQNQSYKPTMVPPTPATRRDPMKYSEKSRDSSKLGLDPIKTKTT
LHHDEPLETPTPSSSTGTDSSRKEIGQEGDVESDADETEMAEQGDMVPELGKKIHH
Download sequence
Identical sequences E0VGW8
121224.XP_002425362 vb|PHUM194120-PA|EEB12624.1|Rho-GTPase-activating XP_002425362.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]