SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425454 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425454
Domain Number 1 Region: 159-232
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 809-871
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000255
Family SAM (sterile alpha motif) domain 0.0074
Further Details:      
 
Domain Number 3 Region: 313-383
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Weak hits

Sequence:  121224.XP_002425454
Domain Number - Region: 105-154
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.1
Family Eukaryotic type KH-domain (KH-domain type I) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425454
Sequence length 893
Comment (Pediculus humanus corporis)
Sequence
MVECYVTIECTKLTFAQTTIIIIIIMRPTYASTDNLSEISESGTGRTGSTSGRSGYSDNR
DELLSILGLTEDDEIFTDRFRIDRKKLEDMIMSDNDALDATQAFFQRIMEGSGTHIAWPT
RLKIGAKSKKDPHVRVAGRSLQDIQTAKDTILSALGIRNKQVTMKLNVSYTHHSHIIGEG
GQTITNVRKQTGCHIHFPDSNRSGTETKSNQVSITGCIEGVEKARNRVRELVPLIFCFEL
PVLGSIQTFPDMNSPYIQQISEKYNVHVSCRTRSRLHATLVVVKGCEWEVDSVKQATLLL
INHMCGKVASQVPVQMTMEISPHHHPMVLGPQSQYLKAIMENTQTKIMFPDAQDPNIPVL
KRSNVTITGQINNVYLARQQLMGSLPINLTFSLSEENMAIDSERINQISEALDVSISTRH
CPKQNNLSVIIKGVERNTSNIYEARRILLNLEEKIEASIPESYKIPNPPKIFDVNEINDI
NSTRALPSILTLDNGSSFPQLSLSDHSPLLMPSLYNPIWGSQLPPGLMSIAWGQMMLPQQ
QQQQQQQQQQQHQQQQQTHQQQQPMIMSRPRPTSTVTGRDISVGSSGYGSQLTLNQFGSM
STSPISDTNGLSAISSFSSNTSSLSTPGVSPRNQSPTMQGMDHQLSLGKTKEMKRQRTID
SAENLLLKNVKEDLSNMMKVTPDWSDQRNLGFDSTPIQTLTPIDYEQKKFLAVKAIQNMP
NSNEVRVPTSAWSGYGFSLTSPSSLFSDQKEFMNSHNDLFDGDPWKNSSDLPPFSNLTER
DQTSSFMSNSNAIESVPSGMLKRIQNCDTDLPTLLASLGLEKYIQLFKSQEIDMSSFLTF
NDVNLKEIGVLAYGARHKMMLAITELKKRQSSLISAAPGAERKRSHGWPKPEQ
Download sequence
Identical sequences E0VH60
vb|PHUM202090-PA|EEB12716.1|bicaudal-C 121224.XP_002425454 XP_002425454.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]