SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425719
Domain Number 1 Region: 244-316
Classification Level Classification E-value
Superfamily ClpS-like 1.94e-16
Family Adaptor protein ClpS (YljA) 0.026
Further Details:      
 
Domain Number 2 Region: 795-877
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000571
Family DNA-binding domain from rap30 0.048
Further Details:      
 
Weak hits

Sequence:  121224.XP_002425719
Domain Number - Region: 368-461
Classification Level Classification E-value
Superfamily PH domain-like 0.00185
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425719
Sequence length 1786
Comment (Pediculus humanus corporis)
Sequence
MDEKAERSHLSFIDDGEMDIPLAHLPKYTESPKNVIDIWLEKMNKGILTPANFKDHWRIW
VPKFYALEPGSEWNMENDKSNCELIDNLEMFIANGDFQEVMKRINNVNQSSSVCGKVFKI
HEPLYTCRECGMDSTCVLCVTCFKNSAHRNHNYKMASGMGGGCCDCGDVEAWKKDPFCDI
HFTGSQLKNDIQKNFPLDMLERCKITFTGILKYAYQVLTLEHSPGLPHDLRLKEAEQDPF
SFSDSPDVYCTVLYNDEIHTFEQVINSLVKIVKCSQRDATEYVTNIDREGRAVVKCTSFQ
QCQELKTDIERFTSKHGGHPLKVEVVHTHVIAHQVFAMKLLRWLQKTLLTCENFRQIFTQ
VALTPIPPDPSIVEGILLRDSKLWKSARSHWHRLFISGMLMEYNSKKALAKVFTKNYGTV
IKDFINDDHDHSFSIASLSVQIFTTPTLTHHLIAEEEVLFILFHTFMSECSRKFNKNGKL
QFDRNVSNQSFKRAQYILYDLKYLFSSVPTESQWTDNLRRGFLQGFSSFLNLLTCMQGMD
SVTRQVIQHMEFEPVWEAAFQLHIKLSLVITLIIKWCGSDKVVLIKAFRATLNKLNECKL
EGTQTNEVRELADHSATCIQFDVATQPVSIHLPLSRFLAGLYLHLGKYNLTFNSPEFQAT
VKPSPEQIIEPILRTQVMIAQVHSAMWRRNGYSLLNQLYLYHSVRCRTEMLDRDVVMLQM
GATLIQSDEFLIHLLNKFNLLNWADPDFEENSLKNREDDSMHQTISLVEEFLGLLIVILG
ERTVPGVGKVTCDDQIKKQIVQQLCIKPMAHSELNKTLPDDVNLETGLEKVIDEVAVFKK
PVQGSGKGVYELKPELYDQYNMYFYHYTKEELSKSEEEQRKRRKTAKELECCPPPKLPLL
TEAFHTLPNLFQCDVMFYIIQTVLKRCLNLRARSFSEHQLQKVLHLIGYALQEEESKEYP
YLMFAEKSMKWNIEKLLEDLLPSARVEAHRDMLTWTLNKFKQVKATRENVEGSVPMCTST
DVPNESSGKDSKEWRAKMAAEKRAKILAQMAAMQKSFMQENAKLFENTISYPEKSGERVS
MMDYSESDEKDPVALGPNQTSKFLCEKTFTCILCQEDTAVSVEGSALVSPAFIQKSTVHA
NSRVGMEKPDEVLAKPLFLPTNFRPQPHTRICSHVMHSSCWRKYFDIVLAKENRRPYRLR
QPMGFDIEKKEFFCPLCECLSNAVLPILPPLGTIKPTTPISEVTFEEYVEGLMVALKHKS
RQQTSTNSPMNFASDEVEDEYFGNSLLRISLLDKVQSEMGEGSGSRFSELFPQDDPPKLS
QSLVDMILFFANATYAKGLNVIPSINNFFVPIMAWNTCYYTILSTESLLADQDKPLMGAL
SSRQKDCLENLTRFAGVLGVVWEKAYDISNHALFLLSMILKNNSKVLALPCILDWDSFGL
LVPLTLSLPNLFCNNAAGNVPTGGILELYTLKLVFLSHVTKILLITEFGGGEMENDDFEN
TTNLSLHESEIVLGVLSSIKKACNYDLSDVWELNADHVWETVKRASLPFLRCCALFYHFL
TDVPYPVCLTELGGDTYEELCKYLSLPLTVTELFESPKYKDLITIWLTHERVPGCLSSKS
FVSLPKAINGLVNLPRDYSELINMVSTFTCPNSDRDDTRNPTMCLVCGEMLCSQSYCCQQ
ELNNISVGACTFHAHRCGANCGIFLRVRECEILLLATPNRGCFLPAPYLDRYGEADPGLS
RGNPLTLSQEQYKKLRFLWLSHGIYEKIARATDSSNNVVATQWQNL
Download sequence
Identical sequences E0VHX5
vb|PHUM216980-PA|EEB12981.1|ubiquitin-protein 121224.XP_002425719 XP_002425719.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]