SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425863
Domain Number 1 Region: 470-569
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000173
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425863
Sequence length 578
Comment (Pediculus humanus corporis)
Sequence
MVYRFHDQVFNKMTPEKRARNLCVMKALSRDSMRLNKNKENENPLNNNTTPFNLKHSTPI
KYRKITDSNYPERISPVDINTTDSENFLEKKKKDPDEPKLVFAKIYELTPNGETNVIETT
TTTTTTTSRNDYSKSSEFEIIVPEKKLQNGELNSRKKESNWKSLNVLNDVAEYEFCKSLE
QSKLCLSTSNLLEEIEADLPSHYSLAKPLNHTFHSLESYRTVTRLARNDKNLTTIDYVET
DVDEGDEKVLLLKKLDFLEMEATIQKAKIRQAQKAMTLSKNKKSMDVEYFECEKTLLLSG
LRLNAALQEMERLKRSQGTANGCFKDNYGQVTIREIVFYVDDVTLNKDGKLYFDQPMKFQ
NLNKDFVINIQLYKRRGKEGKEPKKIFLMKKLKELAGNTLQKTITTSSVGEKHDFECVAS
TRLKLENVSNRKQDKCVLKFSEPPQHPVMRDALVLYLKTDFNVETKDAFGFLNVFNNSCW
QRWWFSQSGYYLNSWLYPEDEENNKVPVYSLHLPSCTEKVKIADLEVCIRPHSFVVVTGP
PNNKEEILFSAESNKDMIKWMNHLNLIIECVRLWKPNA
Download sequence
Identical sequences E0VIB9
XP_002425863.1.24195 vb|PHUM225060-PA|EEB13125.1|conserved 121224.XP_002425863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]