SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002426032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002426032
Domain Number 1 Region: 521-613
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.05e-18
Family Tudor domain 0.0013
Further Details:      
 
Domain Number 2 Region: 382-457
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 3 Region: 568-685
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000418
Family Staphylococcal nuclease 0.0078
Further Details:      
 
Weak hits

Sequence:  121224.XP_002426032
Domain Number - Region: 168-223
Classification Level Classification E-value
Superfamily flu NP-like 0.0602
Family Flu NP-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002426032
Sequence length 714
Comment (Pediculus humanus corporis)
Sequence
MSPSFSAARPFWVWSLPAFAVLLSLLWYRKKRGSLKTDSGGAGETRNDKKSVESSDEEES
PVSEKKSDLIKSGVFDKVIEDIKINGGRGGEEQEEEVKEEEEEEVVEEIINSVKIIDKVE
SAKPPAAVLENFIKPLIKDSLNSCVVDDTKEGIINLTDLTKSGNQTEEQEIIILRNRVVE
ESVLPIQDEDKIQEIKENRNQEEIQVFKSGKFGKKKKMKNSSKKLHDSSKPDAVKQGKEE
NTACILEKKLAKLELEKQCSNNNNNNNNTSGNNKKMAGVNSSSNNNGGGVNGKANNMKAN
NNNNNDKASEGKERNSNSNSNNSGDDFTERDSANNSPSEVMLASPSVSGYSDTHSEGSSD
SGKGCSEMLTPSRTPASGNSVSGDLPVTSIYEFVIPQHLVGRLIGRYGSYVNEIKETTHA
SIYIKRHPDTSKLKICAVEGTQMDIESALDMIRQKFPKKRYPNVTLEQVVISPEPQMIPI
ISESMQLYLIEGINNDVLLSSLVSAGHFFLQQPTHPTYLSLNRLNTCMNYCYSEPDQPLI
PDGVGAGILCAAPVHNGWYRAQIVSMDEDSKICDVKFVDYGGYMTMPVSLLRQIRFDFVN
LPFQAAECYLASVKPSNEENVWCENSKSLVEKLTFGKVLQAQVYGYAEDGIPLIYLYTVV
DDKVILVNEELVNHGLAEWIYPEEDNNNDVVAECVVERDEMEETAAGPVVALTV
Download sequence
Identical sequences E0VIT8
vb|PHUM233260-PA|EEB13294.1|KH XP_002426032.1.24195 121224.XP_002426032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]