SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428257
Domain Number 1 Region: 94-157
Classification Level Classification E-value
Superfamily RING/U-box 2.47e-17
Family ZZ domain 0.0096
Further Details:      
 
Domain Number 2 Region: 395-439
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000199
Family UBA domain 0.0043
Further Details:      
 
Domain Number 3 Region: 19-93
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000617
Family PB1 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428257
Sequence length 440
Comment (Pediculus humanus corporis)
Sequence
MENQLVAYKVYINTENGQKPEVRRFEVSKNLAFDFLHIKQKIVQFFPTIANETFSVYWID
EDGDEISISSDVELETALLETKSDVKKLYVKVNHSNSDHFYTSENDNLNAWHPVIICDSC
DNKVKGFRYKCLVCPDYDLCSSCEKTSLHSEHPMIRLSDAYVLDRRTLYKLMKFFSSHKS
DDLKQNSHHNKKKSFKCTNSEFCKKEKYEKSNSNPKTENLNGSGCRRHHGFGKWKTFNVD
VCKQLIEEYLPYLDPVYFESETDKKENKQKNSDASNNTEEPPHINYLRNIGKTITSILDP
LGIDVDIDVKPSSSKGNEKMKEETKVSSDTSTSTEDKKESTIKISPEKSSYESKVDIKPE
SVNKNTNFSKEQPSSSSESNKSQKSIYPDLRQDTSSSHIEEMLEKMLEMGFDNEGGWLTH
LLKAKNGDIDQVLKVLAPHK
Download sequence
Identical sequences E0VQ63
vb|PHUM372150-PA|EEB15519.1|Sequestosome-1 121224.XP_002428257 XP_002428257.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]