SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428497
Domain Number 1 Region: 12-191
Classification Level Classification E-value
Superfamily PH domain-like 4.65e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000564
Further Details:      
 
Domain Number 2 Region: 303-410
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-27
Family SH2 domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428497
Sequence length 419
Comment (Pediculus humanus corporis)
Sequence
MSRPLPDLFGSEKNIFINKPPQGWLHSDQVILKKGITYAVRYIGCLEVNTSMKSLDFATR
SQVAKECINKVCEVAGLKTVDKKRKIEKAVQRCIGDKPIMDHAGANVNLTVCSSSLILTA
HDSGKVIAGHEMPRISFASGGDTDTLDFVGYVAKDLEDWRACYVLECGGGLAQDVIATIA
QAFDLRLKQFLSTTGPQNEVTTRADDGEYYNDLPGKIPPDVGPPPVPPLPAPHHHHTVIN
VPASESSGFSHQNLKDNGTNLIDLHSDAPIATELEYVNVIPVSSHSNQTTQSNDVFDLRH
LGSTLSNKQSQVIQRNQLEQEIWFHGFINRQEAESLLKKDGEFLVRESQGSPGQYVLTGM
QGGLKKHLLLIDPEGVVRTKDKMFESVNHLINYHVENQLPIISAESALVLRHPVRKASH
Download sequence
Identical sequences E0VQV3
121224.XP_002428497 vb|PHUM387540-PA|EEB15759.1|shc XP_002428497.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]