SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428680
Domain Number 1 Region: 78-176
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-28
Family Ras-binding domain, RBD 0.0031
Further Details:      
 
Domain Number 2 Region: 214-323
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428680
Sequence length 833
Comment (Pediculus humanus corporis)
Sequence
MLSSESSASSGGSSGASKTSSGLGIDVHTKVRNNPKNFSFFFLTQRNESDFVFFFSGFQQ
NETANRAKAEKIKIALEKMKLASVKKLFIKAFTSDGSTKSLLIDEKMTCGYVTRLLADKN
HVTMEPKWAIVEHLPELYMERVYEDHELLVDNLMMWTRDSKNKIIFNERPDKYQLFSNPE
TYLLSSTDILCDYDDHSRAMLLEEFFSATSNTVPEISGPLYLKSESKKGWKKFHFVLRAS
GLYYYPKEKSKSSKDLVCLTSFDINEVYFGVGWKKKFKSPTDYCFAIKHPRLQQPKSTKY
IKYLCADDSITLQKWIVGIRIAKHGRQLLENYRSLLDDLAQEDLDLLAHARSCSVASIAQ
TNLTEIQERTLTRRDSVNSRGGESRASSSSSSGCLSDGASCVEQGFESGTIKRKPSVNPK
LPLTSMTRQLKEVGETVVVDTVIDNENGGTLTRGRTGSETEEGKLSKTGTLTRNSLKEAM
NTLLNQTESISRDESSSKIQNNDFDVDLLPPPSEMFESTLSLSSLPPPPSQSELPVFDES
ELTCSSLSLASLPPFPTSSTTTTTPRVSSPKSDLSTPVSSGGATPVNAFSPDLTPTNRSP
AFSPPSTLSPKVPPKPFHLLKNNNNVVNSIIPYHSQMSNSDSLRSPVKSTPPKKISFNFV
PEEMTTTGTTAESPKKPLPPRRNENTSLTSPKKIASKESTLTPPPKEFLKDLQRVMRKKW
QVAQKCKLDTSTTPHEVLGFRDPPPPVPDYKETNVSNWVQEHYGKTDNLYENVYLVGSKG
MPGSGGNGVVVGGGGFENSIAMAIANKKRPPPPPPKRSETTQLTTTTTTARFH
Download sequence
Identical sequences E0VRD6
121224.XP_002428680 XP_002428680.1.24195 vb|PHUM397090-PA|EEB15942.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]