SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429375
Domain Number 1 Region: 523-681
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 
Domain Number 2 Region: 656-779
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 3 Region: 102-248
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-18
Family Phosphotyrosine-binding domain (PTB) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429375
Sequence length 1064
Comment (Pediculus humanus corporis)
Sequence
MEDSISIKSNESVTTSDEYEFVAKTGIINSNNTSKGEQPLLDIANNGDLNDLCMQLKEVL
SDEDKMESVNTSNSESVTELSKTSTDKDFTECCSEKNDDKKSEYDDDIDVFEDIQQECTI
FNGVTYLGSAAINAPKSEIEIQRNMTILNEQSSEEAIRVSVSVPSSSEGVVVLYDADTQQ
VMARYEIYQILFYARGPADTSEASCFAFTWSHGDNQENAIFQCHVFRCDILEAVGQVSSC
FAKAFQKIPSSMTSSIMQSDGKNMQVFVFEVTMEIKEEDGRGGYSTVPKDRNCFKLRVNL
EKMLCLTVRQVSSNDKLLEIERCFGVLVSPGRNVKHSDMQLLEMARFSGAGETLVVLISG
QWNPLEPAFKPLNVETPRDSKIFMTVALDLVIKRIQHPVRFLIETPVKICPQNERFWYLS
SRKLVQQFYLNLRASESGDSYEVLSIETSGELDRSRLSLTLNLANFILSPSINSVEEIVT
PREDESDNDEPMLSGTGDVSKDCSIIELESWGDVLPRWKRGEERPRQLTALVQNGIPEAL
RCEIWQRLAGCENDRVMMDTFRILITKDCNCENVIQRDINRTFPAHDFFKEAGGLGQDSL
YRISKAYAVYDTEVGYCQGLSFLAATLLLHMPEEQAFCVLIKLMYQYRLRYLYKDGFDCL
HMKLYQLSRLVEEQLPQLSTHLTKNKVEFHMFASQWFLTVFTARFPLFLVFHILDVFLLQ
GEEALFQVALALLTMFRKDLQQLDFESILKYFRVTLPKKCRSKEVAQAVMKLACSLKVKK
LKKYENEYTALKEAQDKAENYTNEMESLKAALERSEEEKKRLEEELVQIKNMLKREVDRA
ESDARRNSSIIADYKQICARLDKESNNIKGKLRDLRNEMSKCENCKSGIKEIEILEEKKN
KENLENLLKEKDPQLNRALERIRELELELAQTKLERVEAECWKQELTHQLHATLAELQTA
KTSWIHKTISSIKEVTNNKKENELLINQISDVPSSGDSGELIKRVFASRRSMKEKELLGN
KEKESNTNNDVSLTTTTTTTTTTTGRKISLSSPEFQDTVNNSNV
Download sequence
Identical sequences E0VTD1
vb|PHUM430800-PA|EEB16637.1|rab6 XP_002429375.1.24195 121224.XP_002429375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]