SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431039 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002431039
Domain Number 1 Region: 59-199
Classification Level Classification E-value
Superfamily PX domain 0.00000000353
Family PX domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431039
Sequence length 434
Comment (Pediculus humanus corporis)
Sequence
MYTNVVSIESKFVTLCKTLVIGFINRNDLDESAVSSIFNESDSKSKALKQVTPYLPQNEI
KVEISDALSEKDKVKFTVQTTKYTSNLEEIKFSVVRQHEEFVWLHDRFEEEPKYIGFIIP
PAPPRPDFDASREKLQKLGEGEGTMTKEEFSKMKQELEAEYLATFKKTVAVHEMFLIRLA
KHPVFKFDYTFQVFLEYDEDLLVRGKNKLEKIGSFMNSVSVTTDEYLLSAKVKDINEFFE
EEKNFLIDYHNHLKDATAKADKMTRKHKDVADCYLHISAGFTQLSTIDHKDLDKFLVKVT
ETFEKARKLEARVASDEDLKLSDTLRFYMRELSAAKRLLYRRLRCLAEYTNANRNLEKVR
TKNKDVHAAEKTQINACNLFQQMDKKAEEELLNFKDRRIADFRKNLVELAELEIKHAKSQ
VSLLKTCLASLKKE
Download sequence
Identical sequences E0VY45
XP_002431039.1.24195 vb|PHUM509260-PA|EEB18301.1|Sorting 121224.XP_002431039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]