SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431355 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002431355
Domain Number 1 Region: 45-124
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431355
Sequence length 126
Comment (Pediculus humanus corporis)
Sequence
MRQIGAANPLAGLAALGLPALNTTNTGGLNPAALAALAGSQLRTNNPSRNQQGNSQQTHE
MTVPNELIGCIIGKGGTKIAEIRQLSGAMIRISNSEEREGGNTDRTITIAGNPEAVALAQ
YLINMR
Download sequence
Identical sequences E0VZ11
121224.XP_002431355 vb|PHUM522830-PA|EEB18617.1|heterogeneous XP_002431355.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]