SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002432217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002432217
Domain Number 1 Region: 20-130
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-27
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 201-271
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000288
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 360-461
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000131
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002432217
Sequence length 474
Comment (Pediculus humanus corporis)
Sequence
MPGRPSNESRLLLKEENILLFSLLGVKCQSLASSVVQLFLTESPNHSQWKRKDAGIMCLV
KDHTKRSYFFRLYCLSRKALVWENELYNSLEYTAPRAWLHTFEAESCMAAFNFADEEEAN
HFQNEVLRTLASKNQKQIERRARNSRQMDGYQGPITNVQHTSYVHNGPDIMQHKKKIAGN
GTKGRDRRRRLRKEDIGQPQDFRHVSHVGWDANRGFEGHGEALENPQLKEILCKAGVSEN
QLRDRSTREFIYGFLERVGGLPPVKNESTKLAKAPPVPSRAPPPAYPLSKPLPSPPTNNI
NTRRQIPPPVNNQRVAPPPPPPPPMSSLPKLPENDKSRNTVAPPPPPPPPPPPLITSEPA
TPPPVPRPSNSSTDARAALMDAIKSGATLKHVDVEKKSVNHMDSRGELLDQIRQGVELKS
VQHVEKPNGPSAPLDGIAGALARALAERSKAFHHDSDSDSDSEGDGDSDSEWDE
Download sequence
Identical sequences E0W1H3
121224.XP_002432217 vb|PHUM577310-PA|EEB19479.1|Neural XP_002432217.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]