SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002432546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002432546
Domain Number 1 Region: 32-222
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-76
Family Sec7 domain 0.000000062
Further Details:      
 
Domain Number 2 Region: 229-350
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-31
Family Pleckstrin-homology domain (PH domain) 0.00000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002432546
Sequence length 371
Comment (Pediculus humanus corporis)
Sequence
MANLKQLKDELQEVVAEMENMDTPDESKNYTKTKQLSIGRKKFNMDPKKGIEYLQEHGLL
QATPEDVAAYLYKGEGLNKTAIGDYLGEKNPFNEKVLKAFVELHDFTDLILVQALRQFLW
SFRLPGEAQKIDRMMECFAQRYCQLNPNIFTNPDTCYVLSFAVIMLNTSLHNPSVKDKPS
AEQFISMNRGINNGGDLNKELLISLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQ
GGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENIQVREASDRHKPHCFELYATGT
DFIKACKTDSEGKVVEGKHTVYRMSAATADEKEDWIKCVRQSISHNPFYDMLAVRKKKAQ
KTAVHHHLTNS
Download sequence
Identical sequences E0W2F2
XP_002432546.1.24195 vb|PHUM591140-PA|EEB19808.1|Cytohesin-1 121224.XP_002432546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]