SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00270
Domain Number 1 Region: 253-630
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.47e-45
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 789-1022
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.32e-35
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 569-778
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.91e-25
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 1021-1102
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Domain Number 5 Region: 50-164
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000105
Family BTB/POZ domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00270
Sequence length 1115
Comment (Caenorhabditis brenneri)
Sequence
MGNREQEAKIDYMHILKEQFSALQTEHLELRRKYDLQCASSTQNSAESENSLPSKLLSIT
ASLLEKPRFSDIRFKFAGSSKEPLPAHKFILAARTSFWKLDDDVAEIQIPDDVDLDAFHV
TMRWIYTDHVDMTMEDEKLLKVCETAANFKLEELKNVCVQQLGSRLNVDNCIQIYEFAEK
QSLRQLSQVCGGMIAASWHQLGPAHFAKMTAPLLYRLIDGNTKNVLHSIVSIGREDVLFL
YFMQNTAKMPGCLNVLDEDGSTALEKALCSDHEKAPLIANQLIEKGADVNVKDVERGETI
LMRMCRKENLPAMDFLLQNGADSRLCQSPGEYNVVHVASRMDSLKLAKWLSDNKEKLDLN
KVDAEGRTPLICSVLSNNHIICESLIRSKVHLDVTTSEGHTALSTCFLMSEAPNRRISEL
LILNGAQVNFKIYSQQVPFLNEIVSRKDTVGVEALLAAGADCQVTDERGITACHVAADVE
ATEIMSRIVEARRGLKWTRDHEDRTPLDISIGKRDLKTARICIKGGADVNARDKNGQTLL
GKAILANDDEIGVFLIEHDARAKEQDRINGKIYLESACERGLLNTVRSFISNGCKLNSRC
STGYSLIHAALSHEKLDVAALLVNFGCDLESKVALSAAGDVLEDGDEGWSTKQTLLHRLI
DDGDQPGAVFLIENGADVNARKEYSNPIEDDQFTPTHMAISWAQNEVLRALKDRGANLCD
VDVDGRTPAHIGVREQNTEGVKILLEAENVEFIPLRDKFGQTILSQSMAMKDHQMASLIV
ERQPHAAVQTNGNGENLLHQAIRQNDIESVLFLLAVAKADPCRAITDGSGKTPLHLAAIA
KDEMILRNLILVNDNVNVTSADGTTPLLEALRHRNDKQAGILMENGAEPNLKDEHGENAM
LCAVRSGSLDCIRAVADSLKTNRYTRNKIGYTSLHICALLTIDKLPKRTTSSDVIELVLS
YEEERNDQLNEKQFASFIDARDADGNTALMIAYSQGNAGVCRSLLKRRACMGQRNNGDVN
VFTYETATKQLLLGLLESLEAEPRWSDGDTCDCGSRFSLTSRKHHCRHCGRHVCSKCSET
TMPIAKYGEEKRVRVCDVCAHVISTGTAPRGAIRN
Download sequence
Identical sequences G0MJI4
CBN00270 135651.CBN00270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]