SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00724 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00724
Domain Number 1 Region: 15-74
Classification Level Classification E-value
Superfamily HMG-box 0.0000017
Family HMG-box 0.008
Further Details:      
 
Weak hits

Sequence:  135651.CBN00724
Domain Number - Region: 73-98
Classification Level Classification E-value
Superfamily HMG-box 0.0432
Family HMG-box 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00724
Sequence length 148
Comment (Caenorhabditis brenneri)
Sequence
MAGFLLTPDEYDNPNPSKGYNLFADAYYKKLGLKTRTEKGGQARKAWEELSDFQRGSYDR
KAAELRKLYRETHPAPKRLQSPYILYFTQESKKIRNAEGKQDLKNQIKVKNPLEFTSWTH
IEPTFKAGEGFPWTKIPGPDGLATMELD
Download sequence
Identical sequences G0MMN6
CBN00724 135651.CBN00724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]