SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN19738 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN19738
Domain Number 1 Region: 305-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-20
Family Clostridium neurotoxins, the second last domain 0.019
Further Details:      
 
Domain Number 2 Region: 143-251,600-686,762-794,835-863,919-989
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000334
Family HspBP1 domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN19738
Sequence length 1729
Comment (Caenorhabditis brenneri)
Sequence
MEISETSHNESGPPIRENGTVESPAEDEVNDEESNMETVDLGMDDTSATDASSPNVFKNI
DNEAPEGPPDVTSSEEAAEAEETSASEEKVEEIVIPSVPTPAPPQDVSPTAAIESLPPLP
EGKELELEDDVTSSLPRLLSKTTLIHSNEEGADETIQRLVTALHSNSPNTDRTQIVDNLF
NLLVGGHFDQESKFVIEEASNVDHMLTLLSHCDADLQNEIWSLFLAVMKKSNRNLEACTR
VGLISKVLDLLPEAPPLLADLLVQIIAALVAYSINVKQTKHLLRALKSTKDQWPPNSLKL
LHVLKEMPQHDSADVFFSFPGKDQSGIILPPIKMMPYQQGWTFATWLRMEPLNSVTFEKE
QPVLYSFRTSKGIGYSCHFTGNCLVVNVEKTKGKEQSRCIRAELGARKWHHIAIAHCYSR
WGRSDIKCFIDGQLAETIELSWVVTSPTNWDRCSIGGSADGTANTAFCGQMGAMYLFAEA
LSLQQANSLFCLGPAYQSTFKHDSETSLPEGYKKHLFDGHLHSSLVFAYCPKNCHGQLCL
YTPPKTAANTYFVQIPHAVMKEGVEVITTHSIHKSLQSVGGIQILLPLFAQIDLPSSHDN
SIDGEVCQTLLSLISLLLSSSQSSQQQLFHSKGFLIISSCLQKASPSHLSMKVLEQLIHI
AKFLLRCPAGGPLLKHLFDYILFNPKLWIRARPEVQVHLYQYLATDFLANNNFSSMLRRV
PTVIEMCHTLKHFYWLALPQTASDYTVEERPENFATADIVAIRSAILTFINRIVVAPSGS
PEEEEKSRDQEVHTLLNLLATVREDDNLYDVLALVTRLLAEQPAIMIPAIDKNKALGIIF
NLLAAPNELIRIPALKILGYFLARSTIKRKTESMGNQNLFSLIGERLLSHKRVLSLPTYN
VLLEILVEQMTSTFSYAAHQPAQPEWKFENPQLLKVIAHVISQCDESESIVQIKKCFLID
IINLCRESKDNRRTILQMSVWQDWLIGLAYVFPTNEAQMEVSELVWEAFSILLHHALRHE
YGGWRVWVDTLAIAHSKVSFEKFKKKLADAKIKAERAENGDEAKMEPTPVYRAPEFAWSD
VHVRLLADLLSGIERTVEEWKVAEGGISDQCNASENQVFVGNVVHVISQLADSLIMACGG
LLPLLASATAPNNDMEIVDPCQQQLPISVAASFLMRFARLVDTFVLASGVSFSELEQEKN
MPAGGVLRQSLRISATVTVRHILASRIQQPDTPRYETNSTKKNQCIMEFVREALEKLSPD
GLENLERLVQDSDITRIKGVVYRDMVEENRQAQFLALSVIYLVSVLMVSRYRDILEPPSS
PSPFFDSTTQKQESIEGDSSKSSPENTANGKLADGDQSSLRNGSDKNENGEEGDDDEENS
EEGQGDDGGRIAAIKVADSGMKTDGNDYNEEELTRIHQSNGRRPSTLMPVQQTAERRAYL
TNKLQTALETCAPLLREMMSDFRGYLQKTLLGTHGQEIMNDTKVLETLRNRNASVIELVM
LLCSQEWQTSLQKHAGLAFIELVNEGRLMAHATRDHVLRVANEADFILNRLRAEDVSKHA
QFEAESREQLAARHEEYSRCDLLIVSGRLRDSLNATRLLEKMSAILSDPDDVKSGTKFWK
LDVWEDDSRRRKRFVPNPYGSRHEEANLPEGEKNEEPEISEQERIRKILKGLFTQRQTTS
GSHELVDESDIDKWAQEVDPTPSSRKFNQKKTVVTPIKMLYLSENEKQS
Download sequence
Identical sequences 135651.CBN19738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]