SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN24577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN24577
Domain Number 1 Region: 133-205
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00034
Further Details:      
 
Domain Number 2 Region: 423-521
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 565-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 710-817
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.12e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 5 Region: 931-1001
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.00071
Further Details:      
 
Domain Number 6 Region: 1007-1078
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 7 Region: 632-708
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.0003
Further Details:      
 
Domain Number 8 Region: 276-351
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000789
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 9 Region: 1074-1155
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Domain Number 10 Region: 210-278
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 11 Region: 853-929
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000137
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 12 Region: 340-413
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.00093
Further Details:      
 
Weak hits

Sequence:  135651.CBN24577
Domain Number - Region: 92-134
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN24577
Sequence length 1222
Comment (Caenorhabditis brenneri)
Sequence
MDNGHIEETNVIDNDNVPPPTTDGAVVFTYNSDFPTLPEAAPASAPTAKQTNVWSRPALS
KADVTTTFHLAPDERSNKVKSFGNTSEESKKAQAIASATKTRIELSESKDGELTVVVKGE
RAKVEEARARIIRDLQTQASREIEIPKEHHGRLIGKEGALLRNLEAETNCRIQIPNRDGP
SSKITITGPREGILRAVQHIQEVSAREAKLATEHIVCPKNLVPFVRGPQNETYDRLTAAN
GVKINIPPPTATNEVISVTGEKEGVHRVAAEIRQILESKKNVTSIQVQVARTQHRYIIGQ
SRSGIHEVLRKTGVVVDVPSEESGSDQITLLGNPADLATALALVIERASSVVTQSIPAPQ
WLHKHLIGPKGATLSTLVPNRNNVQIEFDDSGNIFLEGSPEEVKTAFEPLKKEVARLQME
LAIEKVKVHPTLHRHVIGRGGSLISKIKDQHGVQITIPSEETNSDEIIVEGKKEGVKKAV
AEIRAIVTKIENEKSRDIIIPQRLHKLIIGTKGSGVQVIRDSHPNVSIVFPDAKSKSDVV
NIRGDKAEVDAVYKKLTVLSKEYAENNYQQTVAIFKEFLKHIVGKGGATIRKLRDETETR
IDLPESGSDDGKITVTGKQANVEKAVAQLNKIQEELANVAEETIDIPQKVQARFFGNGRR
LISDIEEECGGVHIRFPSEKSESTKVTIRGPAGDVTKAVGLLSALAKDKEENYIEDTVKA
KPEFHRFLIGKGGSKIAKLRDTLNVRIMFPKDGDAEKETIHLLGKKEDVPKAKAALEEAI
KQLSETVDIKITVDPKYYKNFLVRGAALIKEIQDQNGGVVISFPKNGSDSNEVTIRGSKQ
CVEAARARIEDAVEDYEKQITDTVSIPAQFHRGLLAGRGAKIHELQSKYNVSIRFPNNRE
EGAEGSDQVTISGRDTKVEETKEALLALVPISKVIQLPIDMHRSIIGRGGETVRKLMQDY
DVNISIPKDNSSEDITVTGQAENVEQALEALREKLAEYEALAEDRKLKQWSMIINVPTDY
HQKIIGQRGTTITALKDKYGVNINVPREDGNEAITITGYEEKAKECAAAIEEMISELRSM
FTQEISLDARYHPRLIGQRGKNLKQVMDKYHVEIRLPRQGAEDPNLVIVAGKDENSVYDC
IDFLRREEEEFLLDNLDRHQYISPRQQEPVNTRQQHQPPVAIHMTGAPWQLDIGSSEQFP
DMGASSTPTTAVGGAWGSSRRW
Download sequence
Identical sequences G0NNX2
135651.CBN24577 CBN24577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]