SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000000772 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000000772
Domain Number 1 Region: 40-312
Classification Level Classification E-value
Superfamily L domain-like 6.32e-55
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 245-482
Classification Level Classification E-value
Superfamily L domain-like 1.53e-41
Family Ngr ectodomain-like 0.0092
Further Details:      
 
Domain Number 3 Region: 534-846
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.93e-31
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000000772
Sequence length 904
Comment (Monodelphis domestica)
Sequence
LPAAKMPTLASLWAVWLYAVVCHAGTPQPGPAPACPAPCHCEEDRIMLSVDCSELGLSAV
PGNLNPLTAYLDLSMNNLTELQPGLFLHLRFLEELRLSGNHLSYIPGQAFSGLYSLKILM
LQNNQLSRIPAEALWELPNLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNVLSEIPIR
ALNNLPSLQAMTLALNRIRLIPDYAFQNLTSLVVLHLHNNQIQHLGTNSFEGLHNLETLD
LNYNELLEFPVAIRTLGRLQELGFHNNNIKAIPEKAFVGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGATDITELPDLKGTTSLEILTLTRAGIRLLPLGMCQQLPRLRVLELS
HNHIEDLPSLRRCQKLEEIGLQHNQMWEIGADTFSQLSALRALDLSWNAIQFIHPEAFVT
LHSLIKLDLTHNRLTTLPLAGLGGLVHLKLKGNPSLSEAFSKDSFPQLRILEVPYAYQCC
AYSTCAGFFKASGQWEAEDSHVDEEEAMKKPPGLLGSHTENDLDLDEFQLEMEDSKPHSS
IQCSPSPGPFKPCEHLLESWGIRLAMWVIVLLSLLCNGLVLLAIFVGGPAPLSPVKFVVG
AIAGANILTGISCGLLACVDALTFGQFAQYGARWETGLGCRATGFLAVFGSEASVLLLTL
AAVQCSVSISCVRAFGKSPSLSSVQAGALGCVIVAGLAAALPLASVGEYGASPLCLPYPP
PEGRPVALGFSVALVMMNSLCFLVVTGAYIRLYCHLPRGDYFDAVWDCAMVRHVAWLILT
DGLLYCPVAFLSFASMLSLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFREDFRRL
RPQRRLPGPLAYGVADELEKSSCDSTQALVAFSDVDLVLEASGAGHPPGLEAYGFPSVAF
VSRQ
Download sequence
Identical sequences 13616.ENSMODP00000000772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]