SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000000830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000000830
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-17
Family V set domains (antibody variable domain-like) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000000830
Sequence length 87
Comment (Monodelphis domestica)
Sequence
PLDAGITQTPWHVITRAGQNTDLRCEQNLGHNTLYWYQQDSKMGLRMMFYYNNKALIEKA
NISNRFKPNSPENSRLNLHIESLQAED
Download sequence
Identical sequences F6WLW5
13616.ENSMODP00000000830 ENSMODP00000000830 ENSMODP00000000830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]