SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000001052 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000001052
Domain Number 1 Region: 331-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-33
Family SPRY domain 0.0023
Further Details:      
 
Domain Number 2 Region: 158-267
Classification Level Classification E-value
Superfamily Fibronectin type III 2.79e-16
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000001052
Sequence length 496
Comment (Monodelphis domestica)
Sequence
LGLAQEALKKIITTLAVKNEEIQNFIYALKQMLLNVETNSNKVQEDLEAEFQSLFSLLDE
LKEGMLMKIKQDRASRIYELQNQLAACTKALESSEELLETANQTLQGADNQDFPQAAKQI
KDSVTMAPAFRLSLKAKVSDNMSHLMVDFAQERRLLQALKFLPVPSAPEIDLAESLVADN
CVTLVWRMPDEDGKIDHYVLEYRRTNFEGPPRLKEDHPWMVIEGIRQMEYTLSGLKFDMK
YMNFRVKACNKAVAGEFSEPVTLETTAFMFRLDATTCHQNLRVEELSVEWDAMGGKVQDI
KAREKDNKGRTASPVNSPARCAQSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RYDRDSKAFAVGVAYRSLGRFDQLGKTPASWCLHLNNWLQVSFTAKHNNKARILDVPLPD
CIGVHCDFDKGVLSFYNARTKQLLHTFKAKFNQPLLPAFMVWCGNFQVSSGLQVPSSVRC
LQKRNSATSSSNASLT
Download sequence
Identical sequences 13616.ENSMODP00000001052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]