SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000001127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000001127
Domain Number 1 Region: 61-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-25
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.28e-20
Family Platelet-derived growth factor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000001127
Sequence length 370
Comment (Monodelphis domestica)
Sequence
MYRLILLYTIVCANFCSYWDTLAIPQSGSIKALRSSNLRRDAGNHLTDLYRKEEIIQVMG
NGIIHSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEPENDICRYDFVEVEDIS
ETSTVIRGRWCGQKEVPPRIRSRTNQIKITFKSDDYFVAKPGFKIYYSLVDDFQPPAASE
TNWESVTSSLSGVSYHSPSVTDPTLTADALDQTVAGFDTVEDLLKHFNPETWQEDLENLY
MDTPQYRGRSYYDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELRLTNVVFFPRCLLVQ
RCGGNCGCGSNNWKSCTCTSGKTVKKYHEVLKFEPGHFKRKGKTKNMALIDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences F7F7V7
13616.ENSMODP00000001127 ENSMODP00000001127 XP_001362974.1.35504 ENSMODP00000001127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]