SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000002159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000002159
Domain Number 1 Region: 12-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000785
Family LDL receptor-like module 0.0037
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000002159
Domain Number - Region: 48-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0232
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000002159
Sequence length 88
Comment (Monodelphis domestica)
Sequence
GQIPSSLPQNLIFKCPNRKTWTYIDKVCDMRNDCGDCSDESGLQCSTCSGWRCNTVFFAD
CDCIPKARCKDGIQDCADWSDENMCTED
Download sequence
Identical sequences F6WZ75
ENSMODP00000002159 ENSMODP00000002159 13616.ENSMODP00000002159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]