SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000002882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000002882
Domain Number 1 Region: 369-535
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.24e-27
Family Toll/Interleukin receptor TIR domain 0.00073
Further Details:      
 
Domain Number 2 Region: 24-104
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000101
Family I set domains 0.04
Further Details:      
 
Domain Number 3 Region: 134-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000504
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 217-320
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000274
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000002882
Sequence length 537
Comment (Monodelphis domestica)
Sequence
LFFWLPIMYTLIYFNLSSSFAGRNYAAMENEAFIVECPRRQRSPESQVYWTRFESNENIT
TSKDNRVYSSGDKLKFLPTSVNDSGIYNCTIKSNPNIVGYVNVTIYPKQQGCIFPKNVLY
TSTEGSNTGSWIYCPRYESYNKTSNFEWFKDCKALKGQKYFVKKDYLIIQNTTAADTGNY
TCKFIHSENGVNYNVTATRPLIFQGEIRSSMLPEITYPVNQSVIGVELGTNVSIACKVCL
GRGSQTIEIVRWCIKDNKDKGQCIKDSRFHEEKEAKNPKENLACETVNLRIPNVKKEDLS
LEFYCMGLNQYGWKAHSIRIGIKKTTDLRSTYYLLAGFSILLFLLIILIVILKVFWIDFI
LLWRDIIRPSKSRDDGKIYDAYIIYPRNYKKRTKSVNSLEYFVHHILPEVLEKKCGYTLC
IYGRDLLPGEDAANEMVKCIQKSRRQIIILNPQVEHGEEFAYEQEIALHCALMQNDSKVI
LVEMETTGDTSDLQDSLKHIIKQRGTIKWTGDQATKKQSFNSNFWKRVRYQMPLRSK
Download sequence
Identical sequences F7GDA3
ENSMODP00000002882 ENSMODP00000002882 13616.ENSMODP00000002882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]