SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004261 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004261
Domain Number 1 Region: 71-119
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000031
Family Viral proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004261
Sequence length 411
Comment (Monodelphis domestica)
Sequence
MLRLFFSPLKAVLTSPGIRLLATRGAPRCGSHYGQKLPLLQRQYSTASEIALQSGRRAVP
IPTKATERIMGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWET
EFQKYQQFPEFKILNHDMTLAEFKFIWYMEYSHRMWGRIVGLAYILPAAYFWRRGWLTSG
MKGRVLSLCGLVCFQGLLGWYMVKSGLEEKPDSHDIPRVSQYRLAAHLGSALVLYCASLW
TALSLLLPRDKLPETRQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGER
WIPEDLFTFSPVLKNVFENPTMVQFDHRILGITTVTAITGLYFLSRRIPLPRRAKMAVAT
LLTVAYAQVGLGISTLLMYVPTPLAAVHQSGSLALLSVALWLMNELRRIPK
Download sequence
Identical sequences F7CSQ7
ENSMODP00000004261 13616.ENSMODP00000004261 ENSMODP00000004261 XP_007478708.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]