SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004569 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004569
Domain Number 1 Region: 972-1179
Classification Level Classification E-value
Superfamily vWA-like 4.45e-59
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 114-308
Classification Level Classification E-value
Superfamily vWA-like 2.82e-57
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1198-1402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-33
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 4 Region: 418-585
Classification Level Classification E-value
Superfamily Fibronectin type III 3.51e-20
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 323-411
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-18
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 6 Region: 2-86
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000108
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 711-798
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000023
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 8 Region: 601-683
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000846
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 9 Region: 886-970
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000386
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004569
Sequence length 1661
Comment (Monodelphis domestica)
Sequence
VAPPTRLRYNILSHDSIQIQWKAPKGKFSGYKLLVTPTSGGKTNQLTLQNTANKAIIQGL
IPDQTYAVQLIAFDKDKESKPAQGQFRINDLEKRKEPKPKEPKPKGNGSKPSLPTEGNTF
VCKTPAIADIVILVDGSWSIGRFNFRLVRLFLENLVTAFNVGANKTRIGLAQYSGDPRIE
WHLNTFSTKDAVIDAVRNLPYKGGNTLTGLALNYIFENSFKPEAGARTGVSKIGILITDG
KSQDDIIPASKTLRDSGVELFAIGVKNADVAELQEIASEPDSTHVYNVAEFDLMHTVVEG
LTKTVCTRVEEQEKEIRGSRVTNIGPPTDLVTSEVAARSFRVTWTPAPGEVEKYRVVYYP
TRGGKPEEVVVDGTESTTILKGLMSLTEYQIAVFAIYSTTASEGLRGTEMTLALPMASNL
ELYDVTENSLRVRWNAVPGASGYMILYAPLTEGLAGDEKEMKIGETLTDIQLKGLLPNTE
YTVTVYAMFGEEASDPVTGQEMTLPLSPPRNLRISNVGANSARITWDPTSKNVNGYLISY
TTSSGTETNEVEVDGVSTYSLKGLTSLTDYNVAIFSIYEEGQSEPLMGSFTTKQVPAQQY
LEIDEVSEDSFRVSWKPLSLDVAKQKLMWMPVYGGKVEQVVLNEDQDTYVIEGLQPGTEY
EVSLLAVLSDESETEVLSVFGTTLEGPSTIPPVTTVSPTGPVTTVFRTGIRNLVVDDEST
SSLRVKWDISDNRVEQFRVTYLTAKGDHAEEVIGTVMVPGKQNQLLLKPLLSDTEYKVTV
TPIYSDGEGVSVSAPGKTLPLSWGMAEQRVAYECKNITIRCVWDISVQTVWKHLPIEGWT
LISYQKHSKNLKLTSNSTGSLNKEILLIADMGTALQHIILENLFLGVTDLEAERIQPHSL
CVKWKLHSHASAYRVSIEELRDGNKQETALGGGTSSHCFYGLLADSEHKISVSTQLQEIT
GPSVSIMERTRPIPTPPPATTTPLPTVPPAKEVCKAAKADLVFMVDGSWSIGDDNFNKII
NFLYNTVGALDKIGVDGTQVSIVQFTDDPRTEFMLNTYKTKDTLLEGIKNLSYKGGNTKT
GKALKHVRDALFTAEGGTRRGIPKVIVVITDGRSQDDVNKISRELQLEGISIFAIGVADA
DYAELVSIGSQPSARHVFFVDDFDAFKKIEDELITFVCETASATCPLVNKDGNSLAGFKM
MELFGLVEKDFSAVEGVSMGPGTFNVYPCYQLHKDALVSQPTKYLHPEGLPSDYTISFLF
RILPDTPQEPFALWEILNKDSDPLVGVILDNGGKTITYFNYDYQGEFQTVTFEGPEIKKI
FYGSFHKMHIVISKTLAKVFIDCKQVGEKAVNASGNITSNGVEVLGRMVRSRGPKDNSAP
FQLQMFDIVCSTSWASRDKCCELPGLRDEENCPALPHTCSCSEISKGASGPVGPPGGPGL
RGPKGQRGDQGPKGPDGPRGEAGSPGPQGPPGPQGPSGLSIQGMPGAPGEKGEKGDLGFP
GPQGIPGSTGSPGRDGSQGQRGLPGKDGPTGPSGPPGPIGIPGAPGVPGITGSTGPQGDL
GPPGLPGAKGERGERGDLQSHAMVRAVARQVCEQLIQSHMARYNSILNQIPSHSSSIRTV
PGPPGEPGRQGSPGTPGEQGPPGRPGFPGNPGQPGTPGERG
Download sequence
Identical sequences 13616.ENSMODP00000004569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]