SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000004662 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000004662
Domain Number 1 Region: 102-165
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-17
Family ZZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 392-438
Classification Level Classification E-value
Superfamily UBA-like 4.34e-16
Family UBA domain 0.00022
Further Details:      
 
Domain Number 3 Region: 16-92
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000466
Family PB1 domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000004662
Sequence length 442
Comment (Monodelphis domestica)
Sequence
MERLTVKAYLMGKEETAREIRRFTLDPVDGPGRCEQLLRRVAEVFPALRPGGFQAYYRDE
DGDLIAFSSDEELGMAMCYIKEDILRIYVKEKKECKREHRPPCVQEVPTNMVHPNVICDG
CNGPVVGNRFKCTICPDYDLCNACEAKGLHKEHNMILFQNPFNHPEWISRRRWLQKMRHG
PNFPAFGGWMPGCWGFFPPDALNQIAAQAQTNRTPPNTGAEQASTSSQQDPNVTFLQNVG
ESVAAALSPLGIDVDIDVEHGGKRSKVTPSFSQPSSEEKGSPQPSSSSSSQSQASTQNSE
MEMTLSEKMQKIILASCMQVDKNPLAQTGNSSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SDSTNSMDHSPAGPTGLREAALYPHLPPGKASDPCLIESLSQMLSMGFSDEGGWLTKLLQ
TKNYDIGAALDAIQYSKHAPHP
Download sequence
Identical sequences 13616.ENSMODP00000004662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]