SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000007741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000007741
Domain Number 1 Region: 5-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.53e-65
Family TRADD, N-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 224-305
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000589
Family DEATH domain, DD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000007741
Sequence length 316
Comment (Monodelphis domestica)
Sequence
MADGHQEWSGGAYLFVESTMEKVILSDLYQDPQKKLAVFRALKMALAECSGSQDGAQILK
IHCSGLQLIVQLKFCGQELCGRFLRSYREGALRDALRNSLVPLLDQAQHLGQLHLELHVG
SERLDLMLHEEDRCLRCIHQAKPDRLRDEEISDLEDAFRSLTCDPGGGVALASGPEAPAL
KAPAPKAPAPRVPVHSPPPPMQGQTFVFQGQEFANRPLNSDDQLKFARLVGRKWRTVGRA
LQCPALREQDLENLAYDYDRDGLFEQAFQLLHHFVQAEGRRATLQRLIEALDRSSLTSVA
EDLLGLPRVQEDGDHE
Download sequence
Identical sequences F7FRX7
13616.ENSMODP00000007741 ENSMODP00000007741 ENSMODP00000007741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]