SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000008119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000008119
Domain Number 1 Region: 426-644
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000149
Family HEAT repeat 0.081
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000193
Family APC10-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000008119
Sequence length 926
Comment (Monodelphis domestica)
Sequence
MPHKIGFVVVSSSGHEDGFNAKELMVHAPTVNGWRSPRFCQFPQEIVLQMVERCRVRKLQ
LLAHQYMISSKIEFYISDSLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHKNHVNRYNLYNQVALVAVNIIGDPENCSDESNITSREKLIDHYLGQSSED
SGLDGSYIGKPDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVQKERYDHAKKLKQAI
ADLQKVGERLGRYDVEKRCAVEREDYDLAKEKKQQMEQYRTKVYQQLELHDLLDSQMIRK
PFDLPLAPIVHSNSPRPQKSSQSLLHREEQAGEKPCAEPAKAQLHSPLNVKLQAAMGPPL
PASDSLTKINVDLLPYDERPLPAVLKQQGEVYVEPEKVEEDLVPKGSTAGEPEPLTEKAL
REASSTIDVLGETLVAGAYSKTWSYREDALLSLYNRLMATPVGTPKEDLKNLLRAAIFLI
RRAIKDLVPSVFQTSLKLLKMIITQYIPKHKLGKPETTVTVEKTLPNLLTRTGDSSARLR
IIASNFIQELALCKEIKPLQIIPVHLIQPLKQNSSTHLAMSQTDLLARLLKDLGTENSGF
TVDNVMRFSVSALEHRIFEIREIAIKIILDMYKKHRTLILEYLPADDGNARKNILYKTLF
EGFAKIDGGTTMTMEAQRKATEEAEKQKKEEVKVLQVQLAALREMQAEAQFEKEKESDMG
KMKNQDDPRKKAIHSNPPDVPDDHASVANYLDYLCIFCGERDDSFTEEGLDLHYWKHCPM
LTRCEHCKQVVEIASLTDHLLTECDKRDDFGKCHRCCEAILKEELPRHIKIKACNPARSE
KLANRCPLCHENFTPGEEAWKSHLTGPAGCTMNLRKVYHLQKTQATQLAVDSLMAKSGTS
GSKFGSKIPTPKGGLNKSTSRPYTKR
Download sequence
Identical sequences F7BVI7
13616.ENSMODP00000008119 ENSMODP00000008119 ENSMODP00000008119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]