SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000008217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000008217
Domain Number 1 Region: 56-124
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.15e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 113-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000246
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 214-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000104
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000008217
Domain Number - Region: 171-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000008217
Sequence length 416
Comment (Monodelphis domestica)
Sequence
LQNCLNKQQLLSAIRQMQQLLKGQETRFTEGIRNMKNRLTMLQNSVNKALPDIPAVSCPA
LEAPPNGRKFGSKYFVDHEVHFTCNPGFHLIGPSSLLCQPNGNWTGNRPECKDISECASH
PCQNGGTCVEGVNQYKCTCPQGWTGNNCQQQTQTAAPEWSVTNDPAFSRKPRCAKVDRTQ
HCSCEAGFHMKGTADNSICQDVNECEIYKLEGANQLCMHNCINTPGSFRCSCPAGYRTLE
DGKSCEDIDECADSQHTCTRGTTCINTGGSFQCVNPECPKSSGNVSYVKTSSFQCERNPC
PMDSKSCHHAPKTISFHYLALPSSLKTPITLFRMATASAPGRPGPDSLRFGIVGGNSRGH
FVMQRSDRQTGELILVQSLRGPQTLEVDVDMSEYLDRTFQANHVSKITVFVSPYDF
Download sequence
Identical sequences F7GEP7
13616.ENSMODP00000008217 ENSMODP00000008217 ENSMODP00000008217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]