SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000008236 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000008236
Domain Number 1 Region: 407-515
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.76e-20
Family Mannose 6-phosphate receptor domain 0.0068
Further Details:      
 
Domain Number 2 Region: 210-260
Classification Level Classification E-value
Superfamily EF-hand 0.000054
Family Polcalcin 0.066
Further Details:      
 
Domain Number 3 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000898
Family LDL receptor-like module 0.0048
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000008236
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000008236
Sequence length 531
Comment (Monodelphis domestica)
Sequence
PLLLLLLLITITAAVEVKRPRGVSLTNHHFYDKSKPFTCLDGSSTIPFDQVNDDYCDCQD
GSDEPGTAACPEGRFHCTNAGYKPHYIPSSRVNDGICDCCDATDEYNSGVVCENTCREMG
RKEKETLEQMAEVAREGFRLKKILIEEGKKGQEEKRDNQIKLLGLQESKKTLEEQVAMLR
AVKEEAEKPEKESKERHQRLWEEQQAAAIAARDQEQAASAFQELDDNTDGVISVAELQTH
PELDPDGDGALSEAEAQAFLGEALQVDAAGFREGLWAAIKDKYQQESLPTMPPLTETTVE
EILETPEEPSPTEDEDEGPGLEEEAEEDEDDEEESPEEDKETLPPQPVKVDEEVEKDKMP
PYDERTQAYIDAAQEARDHFEEAEKSLTEMEESIRNLEQEMALDLGPSGEFSYLFGQCYE
LSTNEYIYRLCPFNRVTQKPNHGGSETNLGTWGSWDASEEEKFHVMHYEHGTGCWQGPNR
STKVKLVCGKETVVTSATEPSRCEYLMELVTPAACQEPPPESAGDPDHDEL
Download sequence
Identical sequences F7G4A4
ENSMODP00000008236 ENSMODP00000008236 13616.ENSMODP00000008236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]