SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000008350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000008350
Domain Number 1 Region: 78-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-38
Family Matrix metalloproteases, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 313-377
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000151
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000008350
Sequence length 394
Comment (Monodelphis domestica)
Sequence
MGPGVNPPAEPPGGTARMPSYRALLGLLCLLPALALLLTLKDTADPEARGSQEDVSLPGP
DSLRGTQAPRERLLPPKARRKRYTITPSRLHWDHFNLTYKILSYPRNLINQSETRRGLGA
AFRMWSSVSPFTFREVAPALPSDLKIGFYPINHTDCLRSVVHRCFDGTTGELAHAFFPPN
GEIHFDDSEYWIVGETRFSWKKGVWLTDLVHIAAHEIGHALGLMHSLNPNALMHINATLT
GKKVISQDEMWGMHRLYGCLDRLSVCPSWARRGFCDTRQKFMKKLCPHSCDFCYEFPFPT
VAATPPPPRTKTKLVAEGRNVTFRCGQKIVHKKGKVYWYKDRELLEYSYPGYLDLNEGHM
SIIVNAINEGTYTCVVKKRDRVLTTYSWRIRVNY
Download sequence
Identical sequences F7CDE4
ENSMODP00000008350 13616.ENSMODP00000008350 ENSMODP00000008350 XP_007481153.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]