SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000008846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000008846
Domain Number 1 Region: 896-1113
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-39
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 1272-1471
Classification Level Classification E-value
Superfamily PH domain-like 4.36e-33
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 1103-1218
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-21
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000008846
Sequence length 1473
Comment (Monodelphis domestica)
Sequence
MSRGPKPPIAPKPKLATTNRGKTRVYMNNTFNKFSNGKLICSDGELYEGNQSNPECSESE
ADDDYILPASLSATREEETEAEDPSSSNCSSSFEAKVEETEEDSLSSTDRVDDSNELALG
GDYKRTDSSFQGSPGETETQDPMYENTGEDIDYENDPDEKDKLFVRKERDSLIENQYGYS
LEEEREDCKDIVLTHIASEEPEASGEQPGDPEESLDVGDANSEGYADAEPSSSDCYGVSN
IPPAGGEDEAKNEFNEELEPCDELSKTGLAVEDSEITDWEKEDLVDNGDQDAETKDDQEE
EAAVQGMGEDIQNGEDMLKDEVADESCQIIPFESEGGDELLDSLSGNSFAFLPTESTSFC
SDSYYPLSESVKESEMGAEMDLGSASMGFLQAPLTGLVNNQSGSPDDEAFEVPAVVIVPE
ETLDDETVDDSLIDPYVMGVSLIHRDENSFPGGRGHSETKGEEGTQNNCSTKEEINADAD
SGLITMDRKNIVTRARSHSGKVPGYVPETVPEETGPETDLLSMDSRHTVQEGNKTWLPME
GKPLEINRALPAKPRSFILYPRSFSVEGRDLPVSLYRELEESILDEGRIKRKEDNLSLPC
VIGSSGSFSQRSHLSSSGMSTPSSVVDIPPPFDLACITKKPITKSSPSLLIDNDSPDKYT
KKKKSSFKRFLALTFKKRTENKVHVDVNVSSSRSSSESSYHGPSRVLEIDRRSLSNSPQL
KSRSGKLRASDSPSSIIFYRDIKRKGAPFSRSVSRVESFEDRSRPPFLPLPLTKPRSISF
PNADTSDYENIPAMNSDYENIQIPPRRPTRAGTFTKLFEDPSRALSTANENDGYVDMSSF
NAFESKQQTTDQETESAYTEPYKVCPISAVPTEDVTSDEEQKSSEEEESSQREPGLTHKK
EGQSRAYVIAQELLSSEKAYAQVLQHLMLDFHEAILKALSEETEDNEESLARGELRQGLS
ELPAIYELHQEILSEMEERILNWEEQPKVADIFLTQAPKFDHHVAYIMKFDKNLTLLNGN
CIKSSQLTTTLREFEQNPQSGGQGVKHQLLKVVEHIFQYQVLLTDYLNNLCPDSAEYENT
QDALALISKVTDRANDSMEQGENLQKLVHIEHSVRGQNNLLQPGREFLTEGTLMKVTGKS
RHPRHLFLMSDVLLYTFPQKDGKYRLKNTLTVSSMRVSRPVMEKVPYALKIESAETCLML
SASSCSERDEWYSCLIRTLPEGYQMHTLAAFHNSVEIRERLGICLGERPPTLVPVSHVMM
CMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRLAKVCDGCYAELKKRGGDI
PGLLKERPVSMSFPMSSSRFSSGAFSSVFHSINPSAFKKQKKIPSALTEVAASAEGSAIS
GYLSRRKKGKRHWKTLWFVIKGKVLYTYMASEDKVATESIPLLGFTIAPEEGNRDLGLVF
HLYHKQTLFYSFKAEDTNSAQRWVEAMKDATVL
Download sequence
Identical sequences 13616.ENSMODP00000008846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]