SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000010140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000010140
Domain Number 1 Region: 28-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-88
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-32
Family Spectrin repeat 0.000000755
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-31
Family Spectrin repeat 0.00000417
Further Details:      
 
Domain Number 4 Region: 401-508
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-24
Family Spectrin repeat 0.00000273
Further Details:      
 
Domain Number 5 Region: 742-887
Classification Level Classification E-value
Superfamily EF-hand 2.9e-22
Family EF-hand modules in multidomain proteins 0.0083
Further Details:      
 
Domain Number 6 Region: 638-749
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-20
Family Spectrin repeat 0.00000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000010140
Sequence length 897
Comment (Monodelphis domestica)
Sequence
MMMVLQPDGLGEGQGPYGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSI
GAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFH
TSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNT
PKPDEKAVMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWI
RRTVPWLENRTGEPSMSAMQRKLEDFREYRRLHKPPRVQEKCQLEINFNTLQTKLRLSHR
PAFMPSEGKLVSDIANAWRGLEQAEKGYEDWLLAEIRRLQRLQHLAEKFQQKASLHESWT
RGKEDMLSHRDYESASLQEVRALLRRHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAA
SVNSRCQAICDQWDSLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGAVE
DLQDVWLVHSVEETQSLITAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRLSSSN
PYISLTPQDITSKWEMVRKLVPSRDQTLQEELARQQANERLRRQFAAQANAIGPWIQGKV
EEVGRLAVGLAGSLEEQMAGLRQQEQNIINYKSNVDRLEGDHQLLQESLVFDNKHTVYSM
EHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMMEPDD
FRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVASFKI
LAGDKNYITGEELRRELPPEQAEYCIRRMAPYTGPGAPSGALDYVAFSSALYGESDL
Download sequence
Identical sequences F7EL30
XP_001364941.1.35504 ENSMODP00000010140 13616.ENSMODP00000010140 ENSMODP00000010140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]