SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000010851 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000010851
Domain Number - Region: 33-104
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00282
Family Canonical RBD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000010851
Sequence length 104
Comment (Monodelphis domestica)
Sequence
MGVYGQESGGFSGPGENWSMSGPDNQGRGRGEFDHGGMIRGGRGGGGGGRGGMRAGEYGG
PMEEGPDLDLGPPVDPDEDSKNSAIYVQELNESVTADKMADFFK
Download sequence
Identical sequences F6PVD0
ENSMODP00000010851 13616.ENSMODP00000010851 ENSMODP00000010851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]