SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000011803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000011803
Domain Number 1 Region: 52-332
Classification Level Classification E-value
Superfamily L domain-like 3.4e-61
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 262-496
Classification Level Classification E-value
Superfamily L domain-like 2.92e-37
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 3 Region: 552-851
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.77e-37
Family Rhodopsin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000011803
Sequence length 975
Comment (Monodelphis domestica)
Sequence
GGARAGPQSRALRCARVRPASAAMLCLGLLCFLALGWGSSAGPSGASPPPCPAPCRCDGD
RGVDCTGRGLTAVPGGLSAFTHSLDISMNNITQLPEDAFKNFPFLEELRLAGNDLSFIHP
KALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEESFEGLVQLRHL
WLDDNSLSEVPVRPLSNLPSLQALTLALNKITSIPDFAFNNLSSLVVLHLHNNKIKTLGQ
HCFDGLDNLETLDLNYNNLGEFPQAIKALPNLKELGFRSNYISVIPNGAFSGNPLLKTIH
LNDNPLSFVGNSAFHNLSELHSLVIRGAGMVQGFPNLTGTTNLESLTLTGTKISSIPNNL
CQDRKKLKTLDLSYNNIQELPSFHGCSALEEISLQHNQIHEIKESTFQGLTSLRILDLSR
NLIQEVHNGAFIKLGSITNLDISFNELTSFPTEGLNGLNQLKLTGNFHLKEALSAKDFVN
LRSLSVPYAYQCCAFWGCDSYTNPNADDAGPADHSVSSNQEKGNSDPADLTGRTEKEEHS
QTIIHCTPATGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVLVTTFASRAPWPSSKLF
IGLISVSNLLTGVYTGILTFLDAVSWGRFAEFGIWWETGNGCKVAGFLAVFSSESAIFLL
TLAAVERSLSAREMLKNGKSNHLRQFQAAAALAVLCAAVAGCLPLFHRGQYSASPLCLPF
PTGDSASLGFTVTLVLLNSLAFLLMAIIYTKLYCNLEKEDLSEHSQASTIKHIAWLIFTN
CIFFCPVAFFSFAPLITAISVSPEIMKSVTLIFFPLPACLNPVLYVFFNPQFKEDWKRLR
RHVSRKSGSVAVSISSQGGCVAQDFYYDCSMYSHLQGNLTVCDCCESFLLTKPVSCKHLM
KSHSCPALAVAPCQRPDGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRG
FPLVRYAYNIPRVKD
Download sequence
Identical sequences 13616.ENSMODP00000011803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]