SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000012933 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000012933
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000376
Further Details:      
 
Domain Number 2 Region: 226-310,342-362
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.75e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 409-468
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000012933
Sequence length 480
Comment (Monodelphis domestica)
Sequence
QHNVPSGLLQDHENQRLFALLGRKCWTLATSVAQLYLALPSTGGRWQKELSGAICFVKDN
PRRSYFIRLYGLQEGRLLWEQEIYTQLVYSAPTPFFHTFPGDDCQAGLNFADEAEAQAFR
ALVEEKIQKRSQRQNADRACLPPPPCPRSLGAERRGGATPLPLQPSGDLSASTPGSASLG
LVAVDIQNPDITSSRYRGLPAPTLPPPDKKRSGKKKISKADIGAPSGFKHVSHVGWDPHS
GFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVREEMRRQGPVPPP
PPPSRAGPPQRPPSSSLVGSRGGRSGPLPPLPSGAGGTSSGLPPVPRGPPPPPGRGGPPP
PPPPTFHLGLPAPPQLLPPAPGSGPPPPPPPPPPPPPSPPSSGGAVAPRGRGALLEEIRQ
GIQLNKTPGAQEFPAPPPPSSEGLVGALMHVMQKRSKVIHSSDEEEDQGAEEDEDDEWED
Download sequence
Identical sequences 13616.ENSMODP00000012933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]