SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000013246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000013246
Domain Number 1 Region: 506-616
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 329-440
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-19
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 623-688
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 750-809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000839
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 682-744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 159-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000122
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 7 Region: 270-331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000403
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 445-509
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000472
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000013246
Sequence length 902
Comment (Monodelphis domestica)
Sequence
LAQGHTAGKCLRPDLNPGCPISRAGSQPTELSSCLPDSLXXXXXXTWPLYPWRASTEQSS
PPWSRKGGGGPSAPAPEISPYTSLPLLEHTLLQSPDEAEASIPTAQEAPLEDGASPIPLK
EKMVENELTSSASEESQETTTSTIITTTVITTEQAPALCSVTFSDPEGYIDSNDYAPLPL
HSFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPNLMVLANQTLLVEGQVIRS
PTNTISVYFRTFQDDGIGTFQLHYQAFMLSCSFPRRPAFGDVTVMDLHSGGLAHFHCYLG
YELQGAKTLTCINASKPHWSSQEPICSAPCGGIVHNATIGRVLSPSYPGNTNGSQVCVWT
IEAPEGQKLHLHFERLSLSEKDRMVVYSGRTNKSTVLYDSFQTENVPFEGLLSEGSAIRI
YFMAEEARASTAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTTVEFTCDPGHSLEQ
GPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYAEGEDCIWKIHVGE
DKRIFLDIQFLNLSNSDILTIYDGDEVMSHILGQYLGNSGPQKLYSSSPDLTIQFHSDPA
GLIFGKGQGFVMSYIEVSRNDSCLDLPEIQNGWKTTSHTELVRGAKITYQCDPGYDIVGS
DTLTCQWDLTWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNAGFVLEG
SSLLTCYSRETGTPIWTSRLPHCVSEETLACDNPGLPENGYQILYKRLYLPGESLTFMCY
EGFELMGEVTIKCILGQPSHWSGPLPVCKVNQDSFEHALEVAEAAAETSLEGGNMALAIF
IPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEV
SI
Download sequence
Identical sequences F6YQN8
ENSMODP00000013246 ENSMODP00000013246 13616.ENSMODP00000013246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]