SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000014239
Domain Number 1 Region: 665-693
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000445
Family CCCH zinc finger 0.0028
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000014239
Domain Number - Region: 774-794
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000144
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number - Region: 739-771
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00288
Family CCCH zinc finger 0.0052
Further Details:      
 
Domain Number - Region: 721-743
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0286
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014239
Sequence length 885
Comment (Monodelphis domestica)
Sequence
MEEKEQLRRQIRLLQGLIDDYKNLHGNAPASSTTQWHPSTYSSGRVFGPRYSRPGRRGFP
PHHGPSWRKKYSLVNRPSGSMDQPGDNGSTSVAQPSLSSEDSQDPSSQHYVLERQVQLNS
DQNMVIKIKPPPKSDSLVDSDTYRASVDDNEGSHRIDQRPKEGEGDPPGGKLQGPRPTKL
EGSSSKEDPLLVCLKEPGKPRVVRSMGITPGGSHEPRRTVSESAIVLKSKPTSFQSPRSG
LGRKLGCSLPSSLGLQHSVSDRDSLLSHTSSPTQAEVSVTIRKQGHSPKQVRENCLLVPC
RTNKFRKNNYRWVNSSVKNPRAIRRYSSPRTAPETSRKVSFGTYERAGKSQLRADLDTKS
KKASVTSKPGTSTSKYKWKASSPASSSSSSFLWHSEPASRDRPSHPSAGDSRTPILNRAG
VGASGLKTPYGEAPLSPYKVKSRTKIIRRRGSTSLPVDKKSSPSSSGTPKNHYSLRRRNS
LRGKVTPVLKRTPNKGLVQITKHRLCRLQPSRSTVPAKEAPALHALRTSPSNKVIKTRYR
IVKKNFPSSFSLPAFNIPSSTWKARRLTASRERLNRMRQSALSGKAQTSPPTWKSKGYRC
IGGVMYRVSANKLSKTSGRPQDGNSKHLLRGGELDETTSCSKSPYSRAIQRSLAIIRQAR
QKKEKKRDYCMYYNRFGKCNRGQHCPYIHDPEKVAVCTRFLRGTCKKTDGTCPFSHHVSK
EKMPVCSYFLKGICNNSNCPYSHVYVSKKAEVCVDFLKGYCPMGEKCKKKHMLLCPDFSR
KGSCPRGLQCQLLHRPRKRLNRRSVPPHPPETSDSPTKWKRVRSAAPRPPSSSQQPQPSG
TQQPALLYALGSVSSSCCSSSSSSSSSSSSSSSSSSSSIPRILHH
Download sequence
Identical sequences F6SP47
13616.ENSMODP00000014239 ENSMODP00000014239 ENSMODP00000014239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]