SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000014946
Domain Number 1 Region: 488-578
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-19
Family Canonical RBD 0.00000832
Further Details:      
 
Domain Number 2 Region: 396-480
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-16
Family Canonical RBD 0.0000103
Further Details:      
 
Domain Number 3 Region: 295-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00005
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000014946
Domain Number - Region: 811-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00198
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014946
Sequence length 857
Comment (Monodelphis domestica)
Sequence
TRDSSTMSKSFQQSSLSRDSQGHGRDLSAGIGLLAAATQSLSMPASLGRMNQGTARLASL
MNLGMSSSLNQQGSHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASF
GLSARDLDELSRYPEDKITPENLPQILLQLKRRRTEEGPSLSYGRDGRSATREPPYRVPR
DDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDESF
YGEPSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGFLPKGYPHLCSI
CDMPVHSNKEWNQHINGATHSRRCQLLLEIYPEWNPDNDSGHGMGDPFMLQQSTNPAPGI
LGPPPPSFHLGGPPVGPRGNMGAGNGNMQGPRHMQKGRMETSRVVHIMDFQRGKNLRYQL
LQLVEPFGVISNHLILNKINEAFIEMSTTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYK
RIKKPEGGKPDQKFEQKPELGRVIHLSNLPHSGYSDSAVIKLAEPYGKIKNYILMRMKSQ
AFIEMETREDAMAMVEHCAKKALWFQGRYVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRK
RSYSPDGKDSPSDKKSKTDGSQKSDSGAEGKEQEEKQSEDADKDIKDEQAEQEPGLLLES
EDELLVDEEEAAALLESGSSVGDETDLANLGDVAADIKKEPSEKALKKMEMSLGSSAAAK
KKLKKVDKMEELDQENDGSLENGIKNEDSTEPGGAESAENVEGMDPNQETSENTDGENEI
KREDIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKL
KKFLNKMAEDRRQKKEA
Download sequence
Identical sequences F7DZC2
ENSMODP00000014946 13616.ENSMODP00000014946 ENSMODP00000014946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]