SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000016101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000016101
Domain Number 1 Region: 21-107
Classification Level Classification E-value
Superfamily Immunoglobulin 9.17e-31
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000016101
Sequence length 108
Comment (Monodelphis domestica)
Sequence
MAWTLLLFQLLTLCIGSMAAYVVTQPPSVSMSLGERVSLSCDGDGIGNHLVSWYQLKPGQ
AILPLIYEDSYRPEGIPERFSGSNSGNTATLSISGLQAEDEADYYCFA
Download sequence
Identical sequences F6ZPF9
13616.ENSMODP00000016101 ENSMODP00000016101 ENSMODP00000016101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]